Lineage for d1xlpa_ (1xlp A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2540891Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2540892Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2540944Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (20 PDB entries)
  8. 2540962Domain d1xlpa_: 1xlp A: [122116]
    automated match to d1oqra_
    complexed with fes

Details for d1xlpa_

PDB Entry: 1xlp (more details), 2 Å

PDB Description: structure of oxidized c73s putidaredoxin from pseudomonas putida
PDB Compounds: (A:) putidaredoxin

SCOPe Domain Sequences for d1xlpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d1xlpa_:

Click to download the PDB-style file with coordinates for d1xlpa_.
(The format of our PDB-style files is described here.)

Timeline for d1xlpa_: