![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) |
![]() | Protein 2Fe-2S ferredoxin [54294] (17 species) |
![]() | Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (12 PDB entries) |
![]() | Domain d1xlob1: 1xlo B:1-106 [122115] automatically matched to d1oqqa_ complexed with fes; mutant |
PDB Entry: 1xlo (more details), 1.84 Å
SCOP Domain Sequences for d1xlob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xlob1 d.15.4.1 (B:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw
Timeline for d1xlob1: