SCOPe 2.01: Domain d1xlnb_: 1xln B:

Lineage for d1xlnb_ (1xln B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (17 species)

7. Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (13 PDB entries)

8. Domain d1xlnb_: 1xln B: [122113]
   automated match to d1oqqa_
   complexed with fes

Details for d1xlnb_

PDB Entry: 1xln, 2.03 Å

PDB Description: crystal structure of oxidized c73s/c85s putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida

PDB Compounds: (B:) putidaredoxin

SCOPe Domain Sequences for d1xlnb_:

Sequence; same for both SEQRES and ATOM records:

>d1xlnb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw

Timeline for d1xlnb_:

• d1xlnb_ first appeared in SCOP 1.73, called d1xlnb1
  
• d1xlnb_ was called d1xlnb1 in SCOP 1.75
  
• d1xlnb_ appears in SCOPe 2.02
  
• d1xlnb_ appears in the current release, SCOPe 2.08