Lineage for d1xlnb1 (1xln B:1-106)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854217Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 854218Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 854219Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 854262Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (12 PDB entries)
  8. 854277Domain d1xlnb1: 1xln B:1-106 [122113]
    automatically matched to d1oqqa_
    complexed with fes; mutant

Details for d1xlnb1

PDB Entry: 1xln (more details), 2.03 Å

PDB Description: crystal structure of oxidized c73s/c85s putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida
PDB Compounds: (B:) putidaredoxin

SCOP Domain Sequences for d1xlnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlnb1 d.15.4.1 (B:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw

SCOP Domain Coordinates for d1xlnb1:

Click to download the PDB-style file with coordinates for d1xlnb1.
(The format of our PDB-style files is described here.)

Timeline for d1xlnb1: