Lineage for d1xl9d_ (1xl9 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834536Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2834537Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [141832] (2 PDB entries)
    Uniprot Q81WN7 1-292
  8. 2834545Domain d1xl9d_: 1xl9 D: [122111]
    automated match to d1xkya1
    has additional insertions and/or extensions that are not grouped together

Details for d1xl9d_

PDB Entry: 1xl9 (more details), 2.23 Å

PDB Description: Crystal Structure of Dihydrodipicolinate Synthase DapA-2 (BA3935) from Bacillus Anthracis.
PDB Compounds: (D:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d1xl9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl9d_ c.1.10.1 (D:) Dihydrodipicolinate synthase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvltmteiiekta
ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr

SCOPe Domain Coordinates for d1xl9d_:

Click to download the PDB-style file with coordinates for d1xl9d_.
(The format of our PDB-style files is described here.)

Timeline for d1xl9d_: