Lineage for d1xl9c1 (1xl9 C:1-292)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 684065Protein Dihydrodipicolinate synthase [51574] (4 species)
  7. 684066Species Bacillus anthracis [TaxId:1392] [141832] (2 PDB entries)
  8. 684073Domain d1xl9c1: 1xl9 C:1-292 [122110]
    automatically matched to 1XKY A:1-292

Details for d1xl9c1

PDB Entry: 1xl9 (more details), 2.23 Å

PDB Description: Crystal Structure of Dihydrodipicolinate Synthase DapA-2 (BA3935) from Bacillus Anthracis.
PDB Compounds: (C:) Dihydrodipicolinate synthase

SCOP Domain Sequences for d1xl9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl9c1 c.1.10.1 (C:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]}
midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvltmteiiekta
ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr

SCOP Domain Coordinates for d1xl9c1:

Click to download the PDB-style file with coordinates for d1xl9c1.
(The format of our PDB-style files is described here.)

Timeline for d1xl9c1: