SCOPe 2.08: Domain d1xl9b_: 1xl9 B:

Lineage for d1xl9b_ (1xl9 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (13 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [141832] (2 PDB entries)
   Uniprot Q81WN7 1-292

8. Domain d1xl9b_: 1xl9 B: [122109]
   automated match to d1xkya1
   has additional insertions and/or extensions that are not grouped together

Details for d1xl9b_

PDB Entry: 1xl9, 2.23 Å

PDB Description: Crystal Structure of Dihydrodipicolinate Synthase DapA-2 (BA3935) from Bacillus Anthracis.

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d1xl9b_:

Sequence; same for both SEQRES and ATOM records:

>d1xl9b_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvltmteiiekta
ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr

Timeline for d1xl9b_:

• d1xl9b_ first appeared in SCOP 1.73, called d1xl9b1
  
• d1xl9b_ appears in SCOPe 2.07