Lineage for d1xl3d1 (1xl3 D:2-86)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 928494Fold a.243: Type III secretion system domain [140590] (1 superfamily)
    core: 4 helices, orthogonal array; right-handed superhelix
  4. 928495Superfamily a.243.1: Type III secretion system domain [140591] (3 families) (S)
  5. 928496Family a.243.1.1: TyeA-like [140592] (1 protein)
    Pfam PF09059
  6. 928497Protein TyeA [140593] (1 species)
  7. 928498Species Yersinia pestis [TaxId:632] [140594] (1 PDB entry)
    Uniprot P69968 2-92
  8. 928500Domain d1xl3d1: 1xl3 D:2-86 [122105]
    Other proteins in same PDB: d1xl3a1, d1xl3b_
    automatically matched to 1XL3 C:2-92

Details for d1xl3d1

PDB Entry: 1xl3 (more details), 2.2 Å

PDB Description: Complex structure of Y.pestis virulence Factors YopN and TyeA
PDB Compounds: (D:) protein type A

SCOPe Domain Sequences for d1xl3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl3d1 a.243.1.1 (D:2-86) TyeA {Yersinia pestis [TaxId: 632]}
aydlsefmgdivalvdkrwagihdiehlanafslptpeikvrfyqdlkrmfrlfplgvfs
deeqrqnllqmcqnaidmaieseee

SCOPe Domain Coordinates for d1xl3d1:

Click to download the PDB-style file with coordinates for d1xl3d1.
(The format of our PDB-style files is described here.)

Timeline for d1xl3d1: