SCOPe 2.01: Domain d1xl3c1: 1xl3 C:2-92

Lineage for d1xl3c1 (1xl3 C:2-92)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.243: Type III secretion system domain [140590] (1 superfamily)
   core: 4 helices, orthogonal array; right-handed superhelix

4. Superfamily a.243.1: Type III secretion system domain [140591] (3 families)

5. Family a.243.1.1: TyeA-like [140592] (1 protein)
   Pfam PF09059

6. Protein TyeA [140593] (1 species)

7. Species Yersinia pestis [TaxId:632] [140594] (1 PDB entry)
   Uniprot P69968 2-92

8. Domain d1xl3c1: 1xl3 C:2-92 [122104]
   Other proteins in same PDB: d1xl3a1, d1xl3b_

Details for d1xl3c1

PDB Entry: 1xl3, 2.2 Å

PDB Description: Complex structure of Y.pestis virulence Factors YopN and TyeA

PDB Compounds: (C:) protein type A

SCOPe Domain Sequences for d1xl3c1:

Sequence; same for both SEQRES and ATOM records:

>d1xl3c1 a.243.1.1 (C:2-92) TyeA {Yersinia pestis [TaxId: 632]}
aydlsefmgdivalvdkrwagihdiehlanafslptpeikvrfyqdlkrmfrlfplgvfs
deeqrqnllqmcqnaidmaieseeeelseld

Timeline for d1xl3c1:

• d1xl3c1 first appeared in SCOP 1.73
  
• d1xl3c1 appears in SCOP 1.75
  
• d1xl3c1 appears in SCOPe 2.02
  
• d1xl3c1 appears in the current release, SCOPe 2.08