Lineage for d1xl3c1 (1xl3 C:2-92)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780826Fold a.243: Type III secretion system domain [140590] (1 superfamily)
    core: 4 helices, orthogonal array; right-handed superhelix
  4. 780827Superfamily a.243.1: Type III secretion system domain [140591] (3 families) (S)
  5. 780828Family a.243.1.1: TyeA-like [140592] (1 protein)
    Pfam PF09059
  6. 780829Protein TyeA [140593] (1 species)
  7. 780830Species Yersinia pestis [TaxId:632] [140594] (1 PDB entry)
    Uniprot P69968 2-92
  8. 780831Domain d1xl3c1: 1xl3 C:2-92 [122104]
    Other proteins in same PDB: d1xl3a1, d1xl3b1
    complexed with mly; mutant

Details for d1xl3c1

PDB Entry: 1xl3 (more details), 2.2 Å

PDB Description: Complex structure of Y.pestis virulence Factors YopN and TyeA
PDB Compounds: (C:) protein type A

SCOP Domain Sequences for d1xl3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl3c1 a.243.1.1 (C:2-92) TyeA {Yersinia pestis [TaxId: 632]}
aydlsefmgdivalvdkrwagihdiehlanafslptpeikvrfyqdlkrmfrlfplgvfs
deeqrqnllqmcqnaidmaieseeeelseld

SCOP Domain Coordinates for d1xl3c1:

Click to download the PDB-style file with coordinates for d1xl3c1.
(The format of our PDB-style files is described here.)

Timeline for d1xl3c1: