SCOPe 2.05: Domain d1xl3b_: 1xl3 B:

Lineage for d1xl3b_ (1xl3 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.243: Type III secretion system domain [140590] (1 superfamily)
   core: 4 helices, orthogonal array; right-handed superhelix

4. Superfamily a.243.1: Type III secretion system domain [140591] (3 families)

5. Family a.243.1.3: LcrE-like [140598] (1 protein)
   Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain

6. Protein Outer membrane protein yopN (LcrE) [140599] (1 species)

7. Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries)
   Uniprot P68640 73-269! Uniprot P68640 78-283

8. Domain d1xl3b_: 1xl3 B: [122103]
   Other proteins in same PDB: d1xl3c1, d1xl3d_
   automated match to d1xl3a1

Details for d1xl3b_

PDB Entry: 1xl3, 2.2 Å

PDB Description: Complex structure of Y.pestis virulence Factors YopN and TyeA

PDB Compounds: (B:) Secretion control protein

SCOPe Domain Sequences for d1xl3b_:

Sequence; same for both SEQRES and ATOM records:

>d1xl3b_ a.243.1.3 (B:) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
arvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseepseqfk
mlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqp
lrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgi
visdlqklkefgsvsdqvkgfwqffs

Timeline for d1xl3b_:

• d1xl3b_ first appeared in SCOP 1.73, called d1xl3b1
  
• d1xl3b_ appears in SCOPe 2.04
  
• d1xl3b_ appears in SCOPe 2.06
  
• d1xl3b_ appears in the current release, SCOPe 2.08