SCOP 1.73: Domain d1xl3a1: 1xl3 A:78-283

Lineage for d1xl3a1 (1xl3 A:78-283)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.243: Type III secretion system domain [140590] (1 superfamily)
   core: 4 helices, orthogonal array; right-handed superhelix

4. Superfamily a.243.1: Type III secretion system domain [140591] (3 families)

5. Family a.243.1.3: LcrE-like [140598] (1 protein)
   Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain

6. Protein Outer membrane protein yopN (LcrE) [140599] (1 species)

7. Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries)

8. Domain d1xl3a1: 1xl3 A:78-283 [122102]
   Other proteins in same PDB: d1xl3c1, d1xl3d1
   complexed with mly; mutant

Details for d1xl3a1

PDB Entry: 1xl3, 2.2 Å

PDB Description: Complex structure of Y.pestis virulence Factors YopN and TyeA

PDB Compounds: (A:) Secretion control protein

SCOP Domain Sequences for d1xl3a1:

Sequence, based on SEQRES records:

>d1xl3a1 a.243.1.3 (A:78-283) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
arvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseepseqfk
mlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqp
lrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgi
visdlqklkefgsvsdqvkgfwqffs

Sequence, based on observed residues (ATOM records):

>d1xl3a1 a.243.1.3 (A:78-283) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
arvsdveeqvnqylskvpeqnvsellsllsnspnislsqlkaylegkseepseqfkmlcg
lrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqplrdt
yrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgivisd
lqklkefgsvsdqvkgfwqffs

Timeline for d1xl3a1:

• d1xl3a1 is new in SCOP 1.73
  
• d1xl3a1 appears in SCOP 1.75
  
• d1xl3a1 appears in the current release, SCOPe 2.08