SCOP 1.73: Domain d1xkyd1: 1xky D:1-292

Lineage for d1xkyd1 (1xky D:1-292)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (4 species)

7. Species Bacillus anthracis [TaxId:1392] [141832] (2 PDB entries)

8. Domain d1xkyd1: 1xky D:1-292 [122097]
   automatically matched to 1XKY A:1-292
   complexed with k

Details for d1xkyd1

PDB Entry: 1xky, 1.94 Å

PDB Description: Crystal Structure of Dihydrodipicolinate Synthase DapA-2 (BA3935) from Bacillus Anthracis at 1.94A Resolution.

PDB Compounds: (D:) Dihydrodipicolinate synthase

SCOP Domain Sequences for d1xkyd1:

Sequence; same for both SEQRES and ATOM records:

>d1xkyd1 c.1.10.1 (D:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]}
midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvltmteiiekta
ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr

Timeline for d1xkyd1:

• d1xkyd1 is new in SCOP 1.73
  
• d1xkyd1 appears in SCOP 1.75
  
• d1xkyd1 appears in the current release, SCOPe 2.08, called d1xkyd_