SCOPe 2.08: Domain d1xkya1: 1xky A:1-292

Lineage for d1xkya1 (1xky A:1-292)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (13 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [141832] (2 PDB entries)
   Uniprot Q81WN7 1-292

8. Domain d1xkya1: 1xky A:1-292 [122094]
   complexed with k
   has additional insertions and/or extensions that are not grouped together

Details for d1xkya1

PDB Entry: 1xky, 1.94 Å

PDB Description: Crystal Structure of Dihydrodipicolinate Synthase DapA-2 (BA3935) from Bacillus Anthracis at 1.94A Resolution.

PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d1xkya1:

Sequence; same for both SEQRES and ATOM records:

>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaikdaggdvltmteiiekta
ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr

Timeline for d1xkya1:

• d1xkya1 first appeared in SCOP 1.73
  
• d1xkya1 appears in SCOPe 2.07