Lineage for d1xkva2 (1xkv A:2-211)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712601Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 712602Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 712603Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 712614Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species)
  7. 712624Species Thermus thermophilus [TaxId:274] [82555] (2 PDB entries)
  8. 712627Domain d1xkva2: 1xkv A:2-211 [122090]
    Other proteins in same PDB: d1xkva1, d1xkvb1
    automatically matched to d1j3ba2
    complexed with atp, ca, gol, po4

Details for d1xkva2

PDB Entry: 1xkv (more details), 2.2 Å

PDB Description: Crystal Structure Of ATP-Dependent Phosphoenolpyruvate Carboxykinase From Thermus thermophilus HB8
PDB Compounds: (A:) ATP-dependent phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1xkva2:

Sequence, based on SEQRES records: (download)

>d1xkva2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
spwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfqr
rlvlivgtkyageikksiftvmnylmpkrg

Sequence, based on observed residues (ATOM records): (download)

>d1xkva2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
spwhalfarnmfilprrfgafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvliv
gtkyageikksiftvmnylmpkrg

SCOP Domain Coordinates for d1xkva2:

Click to download the PDB-style file with coordinates for d1xkva2.
(The format of our PDB-style files is described here.)

Timeline for d1xkva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xkva1