![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
![]() | Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [82555] (4 PDB entries) Uniprot Q7SIC6 |
![]() | Domain d1xkva2: 1xkv A:2-211 [122090] Other proteins in same PDB: d1xkva1, d1xkvb1 automated match to d1j3ba2 complexed with atp, ca, gol, po4 |
PDB Entry: 1xkv (more details), 2.2 Å
SCOPe Domain Sequences for d1xkva2:
Sequence, based on SEQRES records: (download)
>d1xkva2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte spwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfqr rlvlivgtkyageikksiftvmnylmpkrg
>d1xkva2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte spwhalfarnmfilprrfgafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvliv gtkyageikksiftvmnylmpkrg
Timeline for d1xkva2: