Lineage for d1xkva1 (1xkv A:212-529)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710202Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 710203Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) (S)
  5. 710204Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (2 proteins)
  6. 710215Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68921] (3 species)
  7. 710225Species Thermus thermophilus [TaxId:274] [82553] (2 PDB entries)
  8. 710228Domain d1xkva1: 1xkv A:212-529 [122089]
    Other proteins in same PDB: d1xkva2, d1xkvb2
    automatically matched to d1j3ba1
    complexed with atp, ca, gol, po4

Details for d1xkva1

PDB Entry: 1xkv (more details), 2.2 Å

PDB Description: Crystal Structure Of ATP-Dependent Phosphoenolpyruvate Carboxykinase From Thermus thermophilus HB8
PDB Compounds: (A:) ATP-dependent phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1xkva1:

Sequence, based on SEQRES records: (download)

>d1xkva1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
vfpmhasanvgkegdvavffglsgtgkttlstdperpligddehgwsedgvfnfeggcya
kvirlspehepliykasnqfeailenvvvnpesrrvqwdddsktentrssypiahlenvv
esgvaghpraifflsadaygvlppiarlspeeamyyflsgytarvagtergvtepratfs
acfgapflpmhpgvyarmlgekirkhaprvylvntgwtggpygvgyrfplpvtrallkaa
lsgalenvpyrrdpvfgfevpleapgvpqellnpretwadkeaydqqarklarlfqenfq
kyasgvakevaeagprte

Sequence, based on observed residues (ATOM records): (download)

>d1xkva1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
vfpmhasanvgkegdvavffglsgtgkttlstdperpligddehgwsedgvfnfeggcya
kvirlspehepliykasnqfeailenvvvnpesrrvqwdddsktentrssypiahlenvv
esgvaghpraifflsadaygvlppiarlspeeamyyflsgytarvtepratfsacfgapf
lpmhpgvyarmlgekirkhaprvylvntgwtggpygvgyrfplpvtrallkaalsgalen
vpyrrdpvfgfevpleapgvpqellnpretwadkeaydqqarklarlfqenfqkyasgva
kevaeagprte

SCOP Domain Coordinates for d1xkva1:

Click to download the PDB-style file with coordinates for d1xkva1.
(The format of our PDB-style files is described here.)

Timeline for d1xkva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xkva2