Lineage for d1xkpc1 (1xkp C:2-127)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611807Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 2611808Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) (S)
  5. 2611809Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins)
    the family sequences are very divergent
  6. 2611819Protein Chaperone protein YscB [142902] (1 species)
  7. 2611820Species Yersinia pestis [TaxId:632] [142903] (1 PDB entry)
    Uniprot Q56973 2-127
  8. 2611821Domain d1xkpc1: 1xkp C:2-127 [122088]
    Other proteins in same PDB: d1xkpa1, d1xkpb1

Details for d1xkpc1

PDB Entry: 1xkp (more details), 1.7 Å

PDB Description: crystal structure of the virulence factor yopn in complex with its heterodimeric chaperone sycn-yscb
PDB Compounds: (C:) Chaperone protein yscB

SCOPe Domain Sequences for d1xkpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkpc1 d.198.1.1 (C:2-127) Chaperone protein YscB {Yersinia pestis [TaxId: 632]}
qnllknlaaslgrkpfvadkqgvyrltidkhlvmlaphgselvlrtpidapmlregnnvn
vtllrslmqqalawakrypqtlvlddcgqlvlearlrlqeldthglqevinkqlallehl
ipqltp

SCOPe Domain Coordinates for d1xkpc1:

Click to download the PDB-style file with coordinates for d1xkpc1.
(The format of our PDB-style files is described here.)

Timeline for d1xkpc1: