Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.198: Secretion chaperone-like [69634] (3 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.1: Type III secretory system chaperone [69635] (1 family) |
Family d.198.1.1: Type III secretory system chaperone [69636] (9 proteins) the family sequences are very divergent |
Protein Chaperone protein YscB [142902] (1 species) |
Species Yersinia pestis [TaxId:632] [142903] (1 PDB entry) |
Domain d1xkpc1: 1xkp C:2-127 [122088] Other proteins in same PDB: d1xkpa1, d1xkpb1 complexed with dmg, mly; mutant |
PDB Entry: 1xkp (more details), 1.7 Å
SCOP Domain Sequences for d1xkpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xkpc1 d.198.1.1 (C:2-127) Chaperone protein YscB {Yersinia pestis [TaxId: 632]} qnllknlaaslgrkpfvadkqgvyrltidkhlvmlaphgselvlrtpidapmlregnnvn vtllrslmqqalawakrypqtlvlddcgqlvlearlrlqeldthglqevinkqlallehl ipqltp
Timeline for d1xkpc1: