SCOP 1.75: Domain d1xkpb1: 1xkp B:2-122

Lineage for d1xkpb1 (1xkp B:2-122)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone-like [69635] (2 families)

5. Family d.198.1.1: Type III secretory system chaperone [69636] (9 proteins)
   the family sequences are very divergent

6. Protein Chaperone protein SycN [142904] (1 species)

7. Species Yersinia pestis [TaxId:632] [142905] (1 PDB entry)
   Uniprot P61380 2-122

8. Domain d1xkpb1: 1xkp B:2-122 [122087]
   Other proteins in same PDB: d1xkpa1, d1xkpc1
   complexed with dmg, mly; mutant

Details for d1xkpb1

PDB Entry: 1xkp, 1.7 Å

PDB Description: crystal structure of the virulence factor yopn in complex with its heterodimeric chaperone sycn-yscb

PDB Compounds: (B:) Chaperone protein sycN

SCOP Domain Sequences for d1xkpb1:

Sequence; same for both SEQRES and ATOM records:

>d1xkpb1 d.198.1.1 (B:2-122) Chaperone protein SycN {Yersinia pestis [TaxId: 632]}
swiepiishfcqdlgvptssplspliqlemaqsgtlqleqhgatltlwlarslawhrced
amvkaltltaaqksgalplragwlgesqlvlfvsldersltlpllhqafeqllrlqqevl
a

Timeline for d1xkpb1:

• d1xkpb1 first appeared in SCOP 1.73
  
• d1xkpb1 appears in SCOPe 2.01
  
• d1xkpb1 appears in the current release, SCOPe 2.08