Lineage for d1xkpb1 (1xkp B:2-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005912Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3005913Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) (S)
  5. 3005914Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins)
    the family sequences are very divergent
  6. 3005921Protein Chaperone protein SycN [142904] (1 species)
  7. 3005922Species Yersinia pestis [TaxId:632] [142905] (1 PDB entry)
    Uniprot P61380 2-122
  8. 3005923Domain d1xkpb1: 1xkp B:2-122 [122087]
    Other proteins in same PDB: d1xkpa1, d1xkpc1

Details for d1xkpb1

PDB Entry: 1xkp (more details), 1.7 Å

PDB Description: crystal structure of the virulence factor yopn in complex with its heterodimeric chaperone sycn-yscb
PDB Compounds: (B:) Chaperone protein sycN

SCOPe Domain Sequences for d1xkpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkpb1 d.198.1.1 (B:2-122) Chaperone protein SycN {Yersinia pestis [TaxId: 632]}
swiepiishfcqdlgvptssplspliqlemaqsgtlqleqhgatltlwlarslawhrced
amvkaltltaaqksgalplragwlgesqlvlfvsldersltlpllhqafeqllrlqqevl
a

SCOPe Domain Coordinates for d1xkpb1:

Click to download the PDB-style file with coordinates for d1xkpb1.
(The format of our PDB-style files is described here.)

Timeline for d1xkpb1: