SCOP 1.75: Domain d1xkpa1: 1xkp A:73-269

Lineage for d1xkpa1 (1xkp A:73-269)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.243: Type III secretion system domain [140590] (1 superfamily)
   core: 4 helices, orthogonal array; right-handed superhelix

4. Superfamily a.243.1: Type III secretion system domain [140591] (3 families)

5. Family a.243.1.3: LcrE-like [140598] (1 protein)
   Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain

6. Protein Outer membrane protein yopN (LcrE) [140599] (1 species)

7. Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries)
   Uniprot P68640 73-269! Uniprot P68640 78-283

8. Domain d1xkpa1: 1xkp A:73-269 [122086]
   Other proteins in same PDB: d1xkpb1, d1xkpc1
   complexed with dmg, mly; mutant

Details for d1xkpa1

PDB Entry: 1xkp, 1.7 Å

PDB Description: crystal structure of the virulence factor yopn in complex with its heterodimeric chaperone sycn-yscb

PDB Compounds: (A:) putative membrane-bound Yop targeting protein YopN

SCOP Domain Sequences for d1xkpa1:

Sequence; same for both SEQRES and ATOM records:

>d1xkpa1 a.243.1.3 (A:73-269) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
lsdsqarvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseep
seqfkmlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgv
nplqplrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgr
eklgivisdlqklkefg

Timeline for d1xkpa1:

• d1xkpa1 first appeared in SCOP 1.73
  
• d1xkpa1 appears in SCOPe 2.01
  
• d1xkpa1 appears in the current release, SCOPe 2.08