Lineage for d1xkpa1 (1xkp A:73-269)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738120Fold a.243: Type III secretion system domain [140590] (1 superfamily)
    core: 4 helices, orthogonal array; right-handed superhelix
  4. 2738121Superfamily a.243.1: Type III secretion system domain [140591] (3 families) (S)
  5. 2738131Family a.243.1.3: LcrE-like [140598] (1 protein)
    Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain
  6. 2738132Protein Outer membrane protein yopN (LcrE) [140599] (1 species)
  7. 2738133Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries)
    Uniprot P68640 73-269! Uniprot P68640 78-283
  8. 2738134Domain d1xkpa1: 1xkp A:73-269 [122086]
    Other proteins in same PDB: d1xkpb1, d1xkpc1

Details for d1xkpa1

PDB Entry: 1xkp (more details), 1.7 Å

PDB Description: crystal structure of the virulence factor yopn in complex with its heterodimeric chaperone sycn-yscb
PDB Compounds: (A:) putative membrane-bound Yop targeting protein YopN

SCOPe Domain Sequences for d1xkpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkpa1 a.243.1.3 (A:73-269) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
lsdsqarvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseep
seqfkmlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgv
nplqplrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgr
eklgivisdlqklkefg

SCOPe Domain Coordinates for d1xkpa1:

Click to download the PDB-style file with coordinates for d1xkpa1.
(The format of our PDB-style files is described here.)

Timeline for d1xkpa1: