Class a: All alpha proteins [46456] (290 folds) |
Fold a.243: Type III secretion system domain [140590] (1 superfamily) core: 4 helices, orthogonal array; right-handed superhelix |
Superfamily a.243.1: Type III secretion system domain [140591] (3 families) |
Family a.243.1.3: LcrE-like [140598] (1 protein) Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain |
Protein Outer membrane protein yopN (LcrE) [140599] (1 species) |
Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries) Uniprot P68640 73-269! Uniprot P68640 78-283 |
Domain d1xkpa1: 1xkp A:73-269 [122086] Other proteins in same PDB: d1xkpb1, d1xkpc1 |
PDB Entry: 1xkp (more details), 1.7 Å
SCOPe Domain Sequences for d1xkpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xkpa1 a.243.1.3 (A:73-269) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]} lsdsqarvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseep seqfkmlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgv nplqplrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgr eklgivisdlqklkefg
Timeline for d1xkpa1: