Lineage for d1xkga1 (1xkg A:4-302)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154852Protein Major mite fecal allergen der p 1 [142848] (1 species)
  7. 2154853Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [142849] (3 PDB entries)
    Uniprot P08176 19-320! Uniprot P08176 99-320
  8. 2154856Domain d1xkga1: 1xkg A:4-302 [122081]
    Other proteins in same PDB: d1xkga2
    complexed with gol, so4, yt3

Details for d1xkga1

PDB Entry: 1xkg (more details), 1.61 Å

PDB Description: Crystal structure of the major house dust mite allergen Der p 1 in its pro form at 1.61 A resolution
PDB Compounds: (A:) Major mite fecal allergen Der p 1

SCOPe Domain Sequences for d1xkga1:

Sequence, based on SEQRES records: (download)

>d1xkga1 d.3.1.1 (A:4-302) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]}
siktfeeykkafnksyatfedeeaarknflesvkyvqsnggainhlsdlsldefknrflm
saeafehlktqfdlnaetnacsingnapaeidlrqmrtvtpirmqggcgsawafsgvaat
esaylayrdqsldlaeqelvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqsc
rrpnaqrfgisnycqiyppnankirealaqthsaiaviigikdldafrhydgrtiiqrdn
gyqpnyhavnivgysnaqgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvil

Sequence, based on observed residues (ATOM records): (download)

>d1xkga1 d.3.1.1 (A:4-302) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]}
siktfeeykkafnksyatfedeeaarknflesvkyvqsnggainhlsdlsldefknrflm
saeafehlktqfdnacsingnapaeidlrqmrtvtpirmqggcgsawafsgvaatesayl
ayrdqsldlaeqelvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqscrrpna
qrfgisnycqiyppnankirealaqthsaiaviigikdldafrhydgrtiiqrdngyqpn
yhavnivgysnaqgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvil

SCOPe Domain Coordinates for d1xkga1:

Click to download the PDB-style file with coordinates for d1xkga1.
(The format of our PDB-style files is described here.)

Timeline for d1xkga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xkga2