Lineage for d1xkea1 (1xke A:7-124)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673276Family b.55.1.3: Ran-binding domain [50764] (4 proteins)
  6. 673294Protein Ran-binding protein 2 [141428] (1 species)
  7. 673295Species Human (Homo sapiens) [TaxId:9606] [141429] (1 PDB entry)
  8. 673296Domain d1xkea1: 1xke A:7-124 [122076]

Details for d1xkea1

PDB Entry: 1xke (more details)

PDB Description: Solution structure of the second Ran-binding domain from human RanBP2
PDB Compounds: (A:) Ran-binding protein 2

SCOP Domain Sequences for d1xkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkea1 b.55.1.3 (A:7-124) Ran-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
ekvlysqrvklfrfdaevsqwkerglgnlkilknevngklrmlmrreqvlkvcanhwitt
tmnlkplsgsdrawmwlasdfsdgdakleqlaakfktpelaeefkqkfeecqrllldi

SCOP Domain Coordinates for d1xkea1:

Click to download the PDB-style file with coordinates for d1xkea1.
(The format of our PDB-style files is described here.)

Timeline for d1xkea1: