Lineage for d1xkea1 (1xke A:3-124)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. Family b.55.1.3: Ran-binding domain [50764] (5 proteins)
  6. Protein Ran-binding protein 2 [141428] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [141429] (1 PDB entry)
    Uniprot P49792 2027-2154
  8. Domain d1xkea1: 1xke A:3-124 [122076]
    Other proteins in same PDB: d1xkea2, d1xkea3

Details for d1xkea1

PDB Entry: 1xke (more details)

PDB Description: Solution structure of the second Ran-binding domain from human RanBP2
PDB Compounds: (A:) Ran-binding protein 2

SCOPe Domain Sequences for d1xkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkea1 b.55.1.3 (A:3-124) Ran-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
geedekvlysqrvklfrfdaevsqwkerglgnlkilknevngklrmlmrreqvlkvcanh
witttmnlkplsgsdrawmwlasdfsdgdakleqlaakfktpelaeefkqkfeecqrlll
di

SCOPe Domain Coordinates for d1xkea1 are not available.

Timeline for d1xkea1:

Domains from same chain:
(mouse over for more information)
d1xkea2, d1xkea3