Lineage for d1xk9a_ (1xk9 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606370Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2606512Protein automated matches [190133] (7 species)
    not a true protein
  7. 2606585Species Pseudomonas aeruginosa [TaxId:287] [186856] (5 PDB entries)
  8. 2606587Domain d1xk9a_: 1xk9 A: [122074]
    automated match to d1dmaa_
    complexed with p34

Details for d1xk9a_

PDB Entry: 1xk9 (more details), 2.1 Å

PDB Description: pseudomanas exotoxin a in complex with the pj34 inhibitor
PDB Compounds: (A:) exotoxin a

SCOPe Domain Sequences for d1xk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk9a_ d.166.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyas

SCOPe Domain Coordinates for d1xk9a_:

Click to download the PDB-style file with coordinates for d1xk9a_.
(The format of our PDB-style files is described here.)

Timeline for d1xk9a_: