SCOPe 2.01: Domain d1xk9a_: 1xk9 A:

Lineage for d1xk9a_ (1xk9 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein automated matches [190133] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [186856] (1 PDB entry)

8. Domain d1xk9a_: 1xk9 A: [122074]
   automated match to d1dmaa_
   complexed with p34

Details for d1xk9a_

PDB Entry: 1xk9, 2.1 Å

PDB Description: pseudomanas exotoxin a in complex with the pj34 inhibitor

PDB Compounds: (A:) exotoxin a

SCOPe Domain Sequences for d1xk9a_:

Sequence; same for both SEQRES and ATOM records:

>d1xk9a_ d.166.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyas

Timeline for d1xk9a_:

• d1xk9a_ first appeared in SCOP 1.73, called d1xk9a1
  
• d1xk9a_ was called d1xk9a1 in SCOP 1.75
  
• d1xk9a_ appears in SCOPe 2.02
  
• d1xk9a_ appears in the current release, SCOPe 2.08