Lineage for d1xk7b_ (1xk7 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885314Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 1885315Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 1885316Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 1885343Protein Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB [117754] (1 species)
  7. 1885344Species Escherichia coli [TaxId:562] [117755] (7 PDB entries)
    Uniprot P31572
  8. 1885346Domain d1xk7b_: 1xk7 B: [122072]
    automated match to d1xa3a_

Details for d1xk7b_

PDB Entry: 1xk7 (more details), 1.6 Å

PDB Description: Crystal Structure- C2 form- of Escherichia coli Crotonobetainyl-CoA: carnitine CoA transferase (CaiB)
PDB Compounds: (B:) Crotonobetainyl-CoA:carnitine CoA-transferase

SCOPe Domain Sequences for d1xk7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk7b_ c.123.1.1 (B:) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]}
shmdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpny
pqlsrrnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpkl
viahlsgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltatt
aalaalhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcgl
ykcadgyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveeklda
wlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimp
kfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved

SCOPe Domain Coordinates for d1xk7b_:

Click to download the PDB-style file with coordinates for d1xk7b_.
(The format of our PDB-style files is described here.)

Timeline for d1xk7b_: