Lineage for d1xk7b2 (1xk7 B:1-405)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. Protein Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB [117754] (1 species)
  7. Species Escherichia coli [TaxId:562] [117755] (7 PDB entries)
    Uniprot P31572
  8. Domain d1xk7b2: 1xk7 B:1-405 [122072]
    Other proteins in same PDB: d1xk7a3, d1xk7b3, d1xk7c3
    automated match to d1xa3a_

Details for d1xk7b2

PDB Entry: 1xk7 (more details), 1.6 Å

PDB Description: Crystal Structure- C2 form- of Escherichia coli Crotonobetainyl-CoA: carnitine CoA transferase (CaiB)
PDB Compounds: (B:) Crotonobetainyl-CoA:carnitine CoA-transferase

SCOPe Domain Sequences for d1xk7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk7b2 c.123.1.1 (B:1-405) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]}
mdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypq
lsrrnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklvi
ahlsgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaa
laalhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglyk
cadgyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawl
athtiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkf
knnpgqiwrgmpshgmdtaailknigysendiqelvskglakved

SCOPe Domain Coordinates for d1xk7b2 are not available.

Timeline for d1xk7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xk7b3
View in 3D
Domains from other chains:
(mouse over for more information)
d1xk7a2, d1xk7a3, d1xk7c2, d1xk7c3