Lineage for d1xk6a1 (1xk6 A:4-405)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713098Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 713099Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (1 family) (S)
  5. 713100Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (4 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 713127Protein Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB [117754] (1 species)
  7. 713128Species Escherichia coli [TaxId:562] [117755] (7 PDB entries)
  8. 713134Domain d1xk6a1: 1xk6 A:4-405 [122067]

Details for d1xk6a1

PDB Entry: 1xk6 (more details), 1.85 Å

PDB Description: Crystal Structure- P1 form- of Escherichia coli Crotonobetainyl-CoA: carnitine CoA Transferase (CaiB)
PDB Compounds: (A:) Crotonobetainyl-CoA:carnitine CoA-transferase

SCOP Domain Sequences for d1xk6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk6a1 c.123.1.1 (A:4-405) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]}
lpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsr
rnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahl
sgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaa
lhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglykcad
gyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawlath
tiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkfknn
pgqiwrgmpshgmdtaailknigysendiqelvskglakved

SCOP Domain Coordinates for d1xk6a1:

Click to download the PDB-style file with coordinates for d1xk6a1.
(The format of our PDB-style files is described here.)

Timeline for d1xk6a1: