Lineage for d1xk4i_ (1xk4 I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710164Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (8 PDB entries)
    Migration inhibitory factor-related protein 8
  8. 2710173Domain d1xk4i_: 1xk4 I: [122063]
    Other proteins in same PDB: d1xk4c_, d1xk4d_, d1xk4g_, d1xk4h_, d1xk4k_, d1xk4l_
    automated match to d1mr8a_
    complexed with ca, cl, flc

Details for d1xk4i_

PDB Entry: 1xk4 (more details), 1.8 Å

PDB Description: Crystal structure of human calprotectin(S100A8/S100A9)
PDB Compounds: (I:) Calgranulin A

SCOPe Domain Sequences for d1xk4i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk4i_ a.39.1.2 (I:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkksh

SCOPe Domain Coordinates for d1xk4i_:

Click to download the PDB-style file with coordinates for d1xk4i_.
(The format of our PDB-style files is described here.)

Timeline for d1xk4i_: