Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
Protein Calcyclin (S100) [47479] (17 species) |
Species Human (Homo sapiens), s100a9 (mrp14) [TaxId:9606] [69020] (2 PDB entries) |
Domain d1xk4h1: 1xk4 H:4-86 [122062] automatically matched to d1irja_ complexed with ca, cl, flc |
PDB Entry: 1xk4 (more details), 1.8 Å
SCOPe Domain Sequences for d1xk4h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xk4h1 a.39.1.2 (H:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim edldtnadkqlsfeefimlmarl
Timeline for d1xk4h1: