Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
Protein Calcyclin (S100) [47479] (17 species) |
Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (2 PDB entries) Migration inhibitory factor-related protein 8 |
Domain d1xk4e_: 1xk4 E: [122059] automated match to d1mr8a_ complexed with ca, cl, flc |
PDB Entry: 1xk4 (more details), 1.8 Å
SCOPe Domain Sequences for d1xk4e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xk4e_ a.39.1.2 (E:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi ntdgavnfqeflilvikmgvaahkkshee
Timeline for d1xk4e_: