| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (11 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.2: S100 proteins [47478] (1 protein) dimer: subunits are made of two EF-hands |
| Protein Calcyclin (S100) [47479] (17 species) |
| Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (2 PDB entries) Migration inhibitory factor-related protein 8 |
| Domain d1xk4e1: 1xk4 E:1-87 [122059] automatically matched to 1XK4 A:1-87 complexed with ca, cl, flc; mutant |
PDB Entry: 1xk4 (more details), 1.8 Å
SCOP Domain Sequences for d1xk4e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xk4e1 a.39.1.2 (E:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkksh
Timeline for d1xk4e1: