SCOP 1.73: Domain d1xjwd2: 1xjw D:101-153

Lineage for d1xjwd2 (1xjw D:101-153)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)

7. Species Escherichia coli [TaxId:562] [57828] (41 PDB entries)

8. Domain d1xjwd2: 1xjw D:101-153 [122048]
   Other proteins in same PDB: d1xjwa1, d1xjwa2, d1xjwb1, d1xjwc1, d1xjwc2, d1xjwd1
   automatically matched to d1acmb2
   complexed with pal, zn; mutant

Details for d1xjwd2

PDB Entry: 1xjw, 2.71 Å

PDB Description: the structure of e. coli aspartate transcarbamoylase q137a mutant in the r-state

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d1xjwd2:

Sequence; same for both SEQRES and ATOM records:

>d1xjwd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d1xjwd2:

• d1xjwd2 is new in SCOP 1.73
  
• d1xjwd2 appears in SCOP 1.75
  
• d1xjwd2 appears in the current release, SCOPe 2.08