SCOPe 2.08: Domain d1xjwd2: 1xjw D:101-153

Lineage for d1xjwd2 (1xjw D:101-153)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
   Uniprot P00478

8. Domain d1xjwd2: 1xjw D:101-153 [122048]
   Other proteins in same PDB: d1xjwa1, d1xjwa2, d1xjwb1, d1xjwc1, d1xjwc2, d1xjwd1
   automated match to d1d09b2
   complexed with pal, zn; mutant

Details for d1xjwd2

PDB Entry: 1xjw, 2.71 Å

PDB Description: the structure of e. coli aspartate transcarbamoylase q137a mutant in the r-state

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1xjwd2:

Sequence; same for both SEQRES and ATOM records:

>d1xjwd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d1xjwd2:

• d1xjwd2 first appeared in SCOP 1.73
  
• d1xjwd2 appears in SCOPe 2.07