SCOPe 2.05: Domain d1xjwd1: 1xjw D:1-100

Lineage for d1xjwd1 (1xjw D:1-100)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (60 PDB entries)
   Uniprot P00478

8. Domain d1xjwd1: 1xjw D:1-100 [122047]
   Other proteins in same PDB: d1xjwa1, d1xjwa2, d1xjwb2, d1xjwc1, d1xjwc2, d1xjwd2
   automated match to d1d09b1
   complexed with pal, zn; mutant

Details for d1xjwd1

PDB Entry: 1xjw, 2.71 Å

PDB Description: the structure of e. coli aspartate transcarbamoylase q137a mutant in the r-state

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1xjwd1:

Sequence; same for both SEQRES and ATOM records:

>d1xjwd1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d1xjwd1:

• d1xjwd1 first appeared in SCOP 1.73
  
• d1xjwd1 appears in SCOPe 2.04
  
• d1xjwd1 appears in SCOPe 2.06
  
• d1xjwd1 appears in the current release, SCOPe 2.08