Lineage for d1xjwb1 (1xjw B:1-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949509Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2949510Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2949511Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2949512Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
    Uniprot P00478
  8. 2949545Domain d1xjwb1: 1xjw B:1-100 [122043]
    Other proteins in same PDB: d1xjwa1, d1xjwa2, d1xjwb2, d1xjwc1, d1xjwc2, d1xjwd2
    automated match to d1d09b1
    complexed with pal, zn; mutant

Details for d1xjwb1

PDB Entry: 1xjw (more details), 2.71 Å

PDB Description: the structure of e. coli aspartate transcarbamoylase q137a mutant in the r-state
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1xjwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjwb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d1xjwb1:

Click to download the PDB-style file with coordinates for d1xjwb1.
(The format of our PDB-style files is described here.)

Timeline for d1xjwb1: