Lineage for d1xjqb1 (1xjq B:229-389)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2088067Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2088068Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2088139Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
    automatically mapped to Pfam PF14306
  6. 2088140Protein ATP sulfurylase N-terminal domain [63802] (5 species)
  7. 2088163Species Human (Homo sapiens) [TaxId:9606] [141702] (3 PDB entries)
    Uniprot O43252 229-389
  8. 2088169Domain d1xjqb1: 1xjq B:229-389 [122038]
    Other proteins in same PDB: d1xjqa2, d1xjqa3, d1xjqb2, d1xjqb3
    automated match to d1x6va1
    complexed with adp

Details for d1xjqb1

PDB Entry: 1xjq (more details), 2.06 Å

PDB Description: adp complex of human paps synthetase 1
PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d1xjqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xjqb1 b.122.1.3 (B:229-389) ATP sulfurylase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dasyevkelyvpenklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereyl
qclhfdclldggvinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrk
eercarqwgttcknhpyikmvmeqgdwliggdlqvldrvyw

SCOPe Domain Coordinates for d1xjqb1:

Click to download the PDB-style file with coordinates for d1xjqb1.
(The format of our PDB-style files is described here.)

Timeline for d1xjqb1: