SCOPe 2.08: Domain d1xjqa2: 1xjq A:390-624

Lineage for d1xjqa2 (1xjq A:390-624)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
   automatically mapped to Pfam PF01747

6. Protein ATP sulfurylase catalytic domain [63980] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142082] (3 PDB entries)
   Uniprot O43252 390-624

8. Domain d1xjqa2: 1xjq A:390-624 [122036]
   Other proteins in same PDB: d1xjqa1, d1xjqa3, d1xjqb1, d1xjqb3
   automated match to d1x6va2
   complexed with adp

Details for d1xjqa2

PDB Entry: 1xjq, 2.06 Å

PDB Description: adp complex of human paps synthetase 1

PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d1xjqa2:

Sequence; same for both SEQRES and ATOM records:

>d1xjqa2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ndgldqyrltptelkqkfkdmnadavsafqlrnpvhnghallmqdthkqllergyrrpvl
llhplggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcra
rmvaganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkk
krmdyydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyyksleka

Timeline for d1xjqa2:

• d1xjqa2 first appeared in SCOP 1.73
  
• d1xjqa2 appears in SCOPe 2.07