Lineage for d1xj7a_ (1xj7 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747981Protein automated matches [190059] (14 species)
    not a true protein
  7. 1748003Species Human (Homo sapiens) [TaxId:9606] [187214] (138 PDB entries)
  8. 1748216Domain d1xj7a_: 1xj7 A: [122031]
    automated match to d1e3ga_
    complexed with dht

Details for d1xj7a_

PDB Entry: 1xj7 (more details), 2.7 Å

PDB Description: complex androgen receptor lbd and rac3 peptide
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d1xj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xj7a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hiegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakal
pgfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmys
qcvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldrii
ackrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvq
vpkilsgkvkpiyfht

SCOPe Domain Coordinates for d1xj7a_:

Click to download the PDB-style file with coordinates for d1xj7a_.
(The format of our PDB-style files is described here.)

Timeline for d1xj7a_: