Lineage for d1xj4b1 (1xj4 B:154-257)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870769Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 870823Family d.110.3.2: Heme-binding PAS domain [55789] (2 proteins)
  6. 870836Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 870837Species Bradyrhizobium japonicum [TaxId:375] [55792] (15 PDB entries)
    Uniprot P23222 152-270
  8. 870840Domain d1xj4b1: 1xj4 B:154-257 [122028]
    automatically matched to d1drma_
    complexed with cl, cmo, hem, na

Details for d1xj4b1

PDB Entry: 1xj4 (more details), 1.8 Å

PDB Description: CO-bound structure of BjFixLH
PDB Compounds: (B:) sensor protein fixl

SCOP Domain Sequences for d1xj4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xj4b1 d.110.3.2 (B:154-257) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]}
damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlt

SCOP Domain Coordinates for d1xj4b1:

Click to download the PDB-style file with coordinates for d1xj4b1.
(The format of our PDB-style files is described here.)

Timeline for d1xj4b1: