SCOPe 2.08: Domain d1xj4a_: 1xj4 A:

Lineage for d1xj4a_ (1xj4 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)

6. Protein Histidine kinase FixL heme domain [55790] (2 species)

7. Species Bradyrhizobium japonicum [TaxId:375] [55792] (19 PDB entries)
   Uniprot P23222 152-270

8. Domain d1xj4a_: 1xj4 A: [122027]
   automated match to d1drma_
   complexed with cl, cmo, hem, na

Details for d1xj4a_

PDB Entry: 1xj4, 1.8 Å

PDB Description: CO-bound structure of BjFixLH

PDB Compounds: (A:) sensor protein fixl

SCOPe Domain Sequences for d1xj4a_:

Sequence; same for both SEQRES and ATOM records:

>d1xj4a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]}
damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh

Timeline for d1xj4a_:

• d1xj4a_ first appeared in SCOP 1.73, called d1xj4a1
  
• d1xj4a_ appears in SCOPe 2.07