Lineage for d1xj3a1 (1xj3 A:154-259)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731664Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 731715Family d.110.3.2: Heme-binding PAS domain [55789] (2 proteins)
  6. 731728Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 731729Species Bradyrhizobium japonicum [TaxId:375] [55792] (15 PDB entries)
  8. 731734Domain d1xj3a1: 1xj3 A:154-259 [122026]
    automatically matched to d1drma_
    complexed with hem

Details for d1xj3a1

PDB Entry: 1xj3 (more details), 1.9 Å

PDB Description: bjFixLH in unliganded ferrous form
PDB Compounds: (A:) sensor protein fixl

SCOP Domain Sequences for d1xj3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]}
damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh

SCOP Domain Coordinates for d1xj3a1:

Click to download the PDB-style file with coordinates for d1xj3a1.
(The format of our PDB-style files is described here.)

Timeline for d1xj3a1: