![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins) |
![]() | Protein Histidine kinase FixL heme domain [55790] (2 species) |
![]() | Species Bradyrhizobium japonicum [TaxId:375] [55792] (19 PDB entries) Uniprot P23222 152-270 |
![]() | Domain d1xj3a_: 1xj3 A: [122026] automated match to d1dp6a_ complexed with hem |
PDB Entry: 1xj3 (more details), 1.9 Å
SCOPe Domain Sequences for d1xj3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xj3a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel
Timeline for d1xj3a_: