Lineage for d1xj2a_ (1xj2 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577003Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)
  6. 2577016Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 2577017Species Bradyrhizobium japonicum [TaxId:375] [55792] (19 PDB entries)
    Uniprot P23222 152-270
  8. 2577035Domain d1xj2a_: 1xj2 A: [122025]
    automated match to d1dp6a_
    complexed with cmo, hem

Details for d1xj2a_

PDB Entry: 1xj2 (more details), 2 Å

PDB Description: CO-bound structure of bjFixLH
PDB Compounds: (A:) sensor protein fixl

SCOPe Domain Sequences for d1xj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xj2a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]}
damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel

SCOPe Domain Coordinates for d1xj2a_:

Click to download the PDB-style file with coordinates for d1xj2a_.
(The format of our PDB-style files is described here.)

Timeline for d1xj2a_: