SCOP 1.75: Domain d1xj0a1: 1xj0 A:1-166

Lineage for d1xj0a1 (1xj0 A:1-166)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (56 PDB entries)
   Uniprot Q6P716

8. Domain d1xj0a1: 1xj0 A:1-166 [122024]
   automatically matched to 1XCM A:1-166
   complexed with gdp, mg; mutant

Details for d1xj0a1

PDB Entry: 1xj0, 1.7 Å

PDB Description: crystal structure of the gdp-bound form of the rasg60a mutant

PDB Compounds: (A:) transforming protein p21/h-ras-1

SCOP Domain Sequences for d1xj0a1:

Sequence; same for both SEQRES and ATOM records:

>d1xj0a1 c.37.1.8 (A:1-166) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtaa
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d1xj0a1:

• d1xj0a1 first appeared in SCOP 1.73
  
• d1xj0a1 is called d1xj0a_ in SCOPe 2.01
  
• d1xj0a1 appears in the current release, SCOPe 2.08, called d1xj0a_