Lineage for d1xj0a1 (1xj0 A:1-166)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 695733Protein cH-p21 Ras protein [52593] (1 species)
  7. 695734Species Human (Homo sapiens) [TaxId:9606] [52594] (52 PDB entries)
  8. 695745Domain d1xj0a1: 1xj0 A:1-166 [122024]
    automatically matched to 1XCM A:1-166
    complexed with gdp, mg; mutant

Details for d1xj0a1

PDB Entry: 1xj0 (more details), 1.7 Å

PDB Description: crystal structure of the gdp-bound form of the rasg60a mutant
PDB Compounds: (A:) transforming protein p21/h-ras-1

SCOP Domain Sequences for d1xj0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xj0a1 c.37.1.8 (A:1-166) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtaa
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOP Domain Coordinates for d1xj0a1:

Click to download the PDB-style file with coordinates for d1xj0a1.
(The format of our PDB-style files is described here.)

Timeline for d1xj0a1: