Lineage for d1xiyb_ (1xiy B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) 
Protein 1-Cys peroxiredoxin [52909] (3 species) Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142367] (2 PDB entries)
Uniprot Q5MYR6 60-238
Domain d1xiyb_: 1xiy B: [122023]
automated match to d1xiya1
Details for d1xiyb_
PDB Entry: 1xiy (more details), 1.8 Å
PDB Description: Crystal Structure of Plasmodium falciparum antioxidant protein (1-Cys peroxiredoxin)
PDB Compounds: (B:) peroxiredoxinSCOPe Domain Sequences for d1xiyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xiyb_ c.47.1.10 (B:) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
endlipnvkvmidvrnmnnisdtdgspndftsidthelfnnkkillislpgaftptcstk
mipgyeeeydyfikennfddiycitnndiyvlkswfksmdikkikyisdgnssftdsmnm
lvdksnffmgmrpwrfvaivennilvkmfqekdkqhniqtdpydistvnnvkeflknn
SCOPe Domain Coordinates for d1xiyb_:
Click to download the PDB-style file with coordinates for d1xiyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xiyb_:
- d1xiyb_ first appeared in SCOP 1.73, called d1xiyb1
- d1xiyb_ appears in SCOPe 2.07
View in 3D
